DPCstruct | MC43452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 5.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 37.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F3R7T6 | 1-98 | MKTSCVWYSQVITKELGIEKFRDYVTKFDYGNRDISGDKGKNNGLTNAGLSSSLEISPEEQLAFLQKLAENKLPVSVKAQEMTKNIL… |
| A0A6N6IKY6 | 105-189 | KRSQVPAFKELARKIGLKTMQESLNKLSYGNAKISKIDTFWLDNSLQISAKNQADLLFKLSQNSLPFSNKSQEEVKKLLLFKENK |
| A0A2T4JWS3 | 54-139 | None |
| Q5QWM3 | 114-199 | None |
| A0A7C3LK53 | 22-95 | None |
| A0A2N5NS38 | 3-94 | None |
| A0A1E3H2A5 | 17-105 | None |
| A0A0N9HPV4 | 112-195 | None |
| A0A377V4Q3 | 17-106 | None |
| A0A678V3P0 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.