DPCstruct | MC4345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14892 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813S431 | 3-88 | SGRTSDFYRTKNLPERFDNPDIMKGYSEKMINPLYKTSNMEYGGKRPNVHTMPVQYHSKSSGFTEHLGKTGMYRNHSLNTAATRSK |
| A0A1X7VCG5 | 1-108 | METASPRLPNNNMATEESRVADPPRTSDFYRTKNIPERFDRPDLIKGYNTVPQNPMYRTSSVTYGSQPPSVHTMPTQYYGKSQAFTK… |
| A0A3P9CFX5 | 40-139 | None |
| A0A6I9XUU6 | 17-104 | None |
| A0A674KBY8 | 1-89 | None |
| A0A3Q0KUW2 | 15-113 | None |
| T1EV58 | 33-142 | None |
| A0A1D2MVH6 | 140-216 | None |
| A0A3B5QPN0 | 10-106 | None |
| A0A226F538 | 60-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.