DPCstruct | MC43448
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Standard deviation of domain lengths | 3.60 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1ZHY4 | 634-688 | KVEVRVMPGNPSAKWPSQRRPYAKHSVDGKYLDKYGNTVPKEAAEAHIPLDEYNF |
| A0A486XL42 | 1-51 | MPGKPHSPFLYQQKPYIVQMKDGKTLDKLGNKVNKNAPEAHVPIDEFIYRN |
| A0A3B8U9C8 | 145-207 | None |
| A0A4D8SGC1 | 125-184 | None |
| A0A829D8K9 | 20-79 | None |
| A0A399XLC4 | 84-143 | None |
| A0A4P7W8N3 | 1170-1229 | None |
| A0A832DPA2 | 70-129 | None |
| A0A7X5Q4C1 | 685-747 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.