DPCstruct | MC43446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 425 ± 47 aa |
| Standard deviation of domain lengths | 46.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0ENW5 | 31-497 | NTYSPNFKGECINTKIEYCEEQNTYGCKRCKEGYYLTKDKKCLKCDDKCETCYGISTYCMSCSNDKYLRNDKTCQSNEELNGTCLQI… |
| A0A0A1UCN1 | 10-365 | DLSTSKCAICEEKYKFDDKKCVSMETTLCSYTSSGNCLHYDLQISFRTSNEGVLKTAIRGEPSCSNCVGNVSTCAKCNVKGGYYQYV… |
| L7FJN1 | 627-1115 | None |
| L7FM88 | 647-1015 | None |
| L7FL40 | 631-1037 | None |
| L7FKL6 | 90-494 | None |
| L7FKU0 | 119-499 | None |
| A0A0A1UB88 | 75-525 | None |
| A0A0A1UBM7 | 388-821 | None |
| A0A5K1VD20 | 76-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.