DPCstruct | MC43443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.08 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183NH50 | 19-107 | HFNQGRLPFGAAQIGSAFRNEISPRSGLIRVREFTMAEIEYFVDPSDKRHPKFEDVRNTEMVLYSSCDQMSGERPRNVTIGEAVDRG… |
| A0A183F059 | 4-87 | QGKLPFAAAQIGSGFRNEISPRQGLIRVREFTMCEIEHFVDPNDKSHPKFGDVRDYELVLFSACNQMDGLPAQTISIGEAVEKV |
| A0A421JW65 | 826-908 | None |
| A0A6I9YKN6 | 135-218 | None |
| A0A5S9XHT9 | 4-80 | None |
| A0A7C4S845 | 10-85 | None |
| A0A7S0MC19 | 3-86 | None |
| A0A1L9UB14 | 239-322 | None |
| A0A822YG00 | 272-360 | None |
| A0A183L9Y6 | 317-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.