DPCstruct | MC43441
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 93.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842LNG6 | 46-137 | VLVPLEDGDRCEALLKMGKEVIAIDLNPLSRTSRKATISIVDNITRAIPRMIEMAEEMKGWNRKKLLEIKKNFDNRENLKRTIREII… |
| A0A7C4GN16 | 1-94 | VLLALEDGDRTEQLVKMGKNVIAIDLNPFSRTARAAKITIVDNVTRAMPILIEYCKKLSTRQPSELAEIIRRFDNETNLKMMVKAIR… |
| A0A645G3B7 | 19-111 | None |
| A0A849QUH0 | 73-187 | None |
| A0A537FQT4 | 99-191 | None |
| A0A842LSP7 | 1-90 | None |
| A0A832U9G1 | 77-163 | None |
| A0A7C2QIX5 | 1-89 | None |
| A0A075GVM6 | 38-119 | None |
| A0A348B4E7 | 111-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.