DPCstruct | MC43440
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 82 ± 5 aa |
| Standard deviation of domain lengths | 5.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q57623 | 459-538 | REVHRVAREKLEEVLKKLNWNGIKAIGEPNNELYGIGVNKDMCGVVTMGGINPLVLLKENEIPIELKAMHEVVRFSDLKS |
| A0A7C4GM45 | 7-82 | AEEKTLEIIDKLVRKGWSGILKIGRPNEPVLGIPVSLDRVGISMAGGITPAAAMVEKGIQIETFAPHCPANIKDMK |
| A0A7W0F625 | 34-115 | None |
| A0A1C3FHK9 | 4-80 | None |
| A0A1V6GAF3 | 20-101 | None |
| A0A7C2QKT7 | 147-223 | None |
| A0A0A0DX14 | 2-74 | None |
| A0A843FJV7 | 87-170 | None |
| A0A7C5EQR5 | 58-141 | None |
| A0A1V5D9Y9 | 92-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.