DPCstruct | MC4344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 140 ± 14 aa |
| Standard deviation of domain lengths | 14.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7V9I3 | 1-140 | MSQQALDEFWEMATSEMLSVLRHHCLHCQDNYLLLKIKQSIVWFCHTVMGHGFNNDKLYEVALEIREHYDELLMKTNADAFKNLLVT… |
| A0A1V4K211 | 126-265 | VNRAYIDELWEMALSKTIAALRTHSSYCSDPSLVLDLKNLIVLFADTLQGYGFPVNQLFDMLLEIQDQYSETLLKKWSGVFRNILDS… |
| A0A401T3T3 | 146-284 | None |
| A0A653BV14 | 33-172 | None |
| A0A2N1JGK4 | 325-498 | None |
| A0A674C9R7 | 420-548 | None |
| A0A3B3Z814 | 33-171 | None |
| A0A803VYC8 | 1-137 | None |
| A0A6V7QTG1 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.