DPCstruct | MC43435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Standard deviation of domain lengths | 6.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 50.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F1A050 | 74-167 | KGKDFNQNMPYIVVIDCETPMPSQIAKVSIQNGEADILNFNEAHLMWTPYVLPKSANNVKSKQEYKIFTLTLQERAGKQLSEDKLNT… |
| A0A446JAL1 | 1-87 | MCVVQVDCPCAPSDKVGINSVQRAYEEILPMRAMKMSWVPYVPLEDRLSRIEGLKTKIFTLHCSQRRSALKHLKTEQVKKFDYCMPC |
| A0A2U1N7U7 | 60-147 | None |
| A0A7C9B115 | 1-105 | None |
| A0A5J5NWM5 | 23-117 | None |
| A0A453TDM5 | 1-88 | None |
| A0A6A3C036 | 153-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.