DPCstruct | MC43431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 85 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 49.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446J165 | 14-93 | QPNEVDKALQACQVAERKVCVSLLKLGRWFYGFRLPDDYESYKNSLSWLTSDDGAKVLVILNRGAVHEVFRLQVSLVGTN |
| A0A0V0HFQ4 | 61-160 | LHYCLIWLGLPGECVMEILNNSNISQREVRVQWWKLGRWLFGFRLRDELITRTVSLEDLATGKEEEVLGVLHRGAVHEVIRVQISEA… |
| A0A835PHL5 | 184-267 | None |
| A0A833RGN7 | 154-239 | None |
| A0A7J7PBU1 | 398-489 | None |
| A0A388L1B8 | 294-382 | None |
| A0A7I8KRL4 | 157-241 | None |
| A0A540N962 | 248-331 | None |
| A0A7J8ZRW5 | 3-69 | None |
| D7T6I9 | 739-826 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.