DPCstruct | MC4343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 7.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182GME2 | 276-344 | EIMGYSLRTKQFRYTAWIGFDPNTFKRNWSKIYGEELYDHTIDPKENMNLVDRPQLVTIVEWLRLRLQE |
| A0A1X7V7T7 | 213-285 | NVMGYTIRTDKYRFTEWYTFDRDTSKPDFDKKWGTELYDHSTPTVSFNDENINIADKPEMESTVTELRKALQD |
| A0A7S3AUA1 | 21-102 | None |
| A0A6I8QGR2 | 281-346 | None |
| A0A821M7Q9 | 150-218 | None |
| A0A1X7TDX5 | 81-166 | None |
| E9IHD7 | 312-390 | None |
| A0A0B7BQE2 | 1-74 | None |
| A0A812X375 | 59-145 | None |
| A0A7S0FTB8 | 3-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.