DPCstruct | MC43429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 2.79 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 68.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446IYB8 | 1-67 | MQVDMFLTKLTSICKRSTEKGSMWVTMKRLSMKCQARLKKMASKGEPVEYRCLVCATDGKRNISTSK |
| A0A835VEA5 | 21-87 | LQPDPFLNELTSMFEQTKEKGSVWVTFKRSSMKSKAKKNKMETAGEDIEYKCLVRATDSKKSISTAV |
| A0A835MV46 | 2-70 | None |
| A0A540M564 | 4-70 | None |
| A0A2H5N3J8 | 1-66 | None |
| A0A5A7Q1C7 | 4-69 | None |
| A0A3B6EEZ6 | 44-117 | None |
| A0A835DF92 | 4-66 | None |
| A0A1U8AYP5 | 42-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.