DPCstruct | MC43428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 56 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 61.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00572 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0GTY9 | 1-55 | MVSGSGVCAPRVVVDARHHMLSRLASIIAKELLNGKRVVVVRCEEICMSGGLVRQ |
| A0DXV9 | 1-46 | MFEKEIVIDGKGHLLGRLASYIVKQLQRRQRIVVLRTELIQQLGNM |
| A0A0E0GTY8 | 1-55 | None |
| A0A3B4DZ56 | 7-57 | None |
| A0A0E0P1H6 | 476-536 | None |
| A0A485NCD3 | 1-50 | None |
| A0A2G5CXS1 | 1-61 | None |
| A0A0E0Q389 | 676-736 | None |
| A0A818PT30 | 9-65 | None |
| A0A835FTI3 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.