DPCstruct | MC43424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Standard deviation of domain lengths | 15.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9MYA9 | 1-125 | MAEGGEGEEEIQFLRTEDQVVLQCTASVMKDQQVKLCLSCEGFGNRLCFLETTSNAQNVPPDLAICSFVLVQSLSVRALQEMLAKRV… |
| A0A3Q4HQR4 | 1-114 | MTDSGEGDDEFQFLRTGDEVVLQSTFTSQEEHVKLCLAAEGFGSRLCRLEPTSNCKNVPPDLSVCGFVLAQCLSVRALQEMLAHSEH… |
| A0A0D8Y974 | 17-124 | None |
| A0A0B2VGZ6 | 8-120 | None |
| A0A3B3YMI0 | 17-134 | None |
| A0A3B3YC20 | 1-112 | None |
| A0A484C9I7 | 37-171 | None |
| A0A6V7X246 | 17-167 | None |
| A0A6A4IH52 | 1-98 | None |
| A0A1S3QFK2 | 75-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.