DPCstruct | MC43421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.90 |
| Pfam Score | 98.48 |
| Assigned Pfam label(s) | CL0023- CL0671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4H4Y6 | 125-219 | NREDIGVDFVHLLVNNFITHSELMSGHLIDFFVPFLPLEYRHIKLCARDAYAARGLETDEATLDEVAKAMLYVPKEERLFSAQGCKS… |
| A0A3P7FG55 | 5-98 | VIASAFNTEGGLKMSELISAHLIDHFVPFLPLERRHILLCIRDYMISHGFTPTDEHITAIADSLQYFPKTNPIYSSSGCKRVAQKTE… |
| A0A183J9Q1 | 123-229 | None |
| A0A498N8P0 | 402-504 | None |
| G1SRZ0 | 144-245 | None |
| A0A834BC37 | 18-112 | None |
| A0A2B4S9E1 | 87-193 | None |
| A0A2B4SBN3 | 482-587 | None |
| A0A834U6C4 | 1177-1271 | None |
| A0A5A9N9G7 | 283-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.