DPCstruct | MC43420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 169 ± 31 aa |
| Standard deviation of domain lengths | 30.84 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 70.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4H3L2 | 11-173 | DIIVKNPWRQGSTLELSHNEAARLATDALLEHGEKEYRKVLTEEREVNFLSPLEIHYITQHAASKTCGGSDSNGVGPGDRDFGDGDA… |
| A0A3B3QYP3 | 3-257 | PQSGRFSRCHRVGKVRRRVQEMRYRSFLVSEIDLSHNESARLATDALLGRSLEAYREVLAHEREVDFLSREEKDYILKNANGPREDE… |
| G3NQ61 | 55-219 | None |
| A0A6J2NIX4 | 136-397 | None |
| S4RW03 | 21-160 | None |
| A0A4W6FMH8 | 1-160 | None |
| A0A498NVK9 | 1-148 | None |
| E7F4B5 | 1-152 | None |
| W5LZH5 | 1-156 | None |
| L9KI61 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.