DPCstruct | MC4342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 145 |
|---|---|
| Mean domain length (aa) | 322 ± 73 aa |
| Standard deviation of domain lengths | 73.15 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.75 |
| Pfam Score | 98.77 |
| Assigned Pfam label(s) | CL0023- CL0375- PF16791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q4I5H4 | 5-185 | LQSWTHLPMLGRFWLVLVLVFRILILGTVASEMFEDEQEEFTCNTLQPGCKQVCYDEAFPISQYRFWVFHLILIATPSLLYFVRKNR… |
| A0A1X7V5R0 | 53-383 | VTGNIPGDTPITQKDFYWDQILFYLVSAILGLSFLDVSIEFFRDSSIIKCYISDTTITRDQVAYFNNYCYSSLPNSQYYLIFILISA… |
| A0A1I8HWS9 | 1-440 | None |
| A0A1A8BSJ8 | 24-328 | None |
| A0A2B4SDU3 | 1-267 | None |
| K7FDB5 | 1-324 | None |
| A0A6P8HHL7 | 421-849 | None |
| A0A818VQW3 | 527-997 | None |
| M3W761 | 234-557 | None |
| A0A2A2KIC1 | 6-385 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.