DPCstruct | MC43417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 106 ± 12 aa |
| Standard deviation of domain lengths | 11.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 94.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497P1R2 | 1-103 | MRIEREQKIFEIGGVKIGGQPGELPTVLIGSLFHEGHKIVKDRRLGIFDKKKAEQLIRMQDEISNETGVPCMLDIVAEYPEALIKYI… |
| A0A5E4HKT6 | 2-105 | FRFDKKQEVFEFGKIKVGGQPGEYPTVLVSTMFYLKHKIVTDEDHGVFDKAAAEKLWNTQEVMGDTTGNPYFNQLVGETPEAIKKYI… |
| A0A7J3D6P0 | 5-89 | None |
| A0A7J3NMP5 | 215-341 | None |
| A0A842SZN0 | 1-109 | None |
| Q12TW9 | 147-259 | None |
| A0A6A8ASW2 | 2-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.