DPCstruct | MC43414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 10 aa |
| Standard deviation of domain lengths | 10.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A497IBS4 | 6-96 | HELLRELLSRHTGQELSDVKVVRAGRYWIDVKPDHGGFWESFKKRFDPSLEKALRLDALTEKRYCPTFPSIQQLFTWLTECTGDKTF… |
| A0A497NRY8 | 1-97 | MLCRAVPEVLVEAAIVSHWTSGGEDEYFIFVYPDHAEYWTHFRKRYPYYKQVALRYGASAGSQYCPVFPTREKLIYWLSDVLNLSQG… |
| A0A497NXH9 | 2-101 | None |
| A0A661QYA5 | 40-147 | None |
| A0A497NVA2 | 1-82 | None |
| A0A497LQI4 | 16-111 | None |
| A0A497NS75 | 2-120 | None |
| A0A661K9S9 | 3-107 | None |
| A0A497NU61 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.