DPCstruct | MC43410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 122 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6Y6P0 | 1-115 | MQIEQTGEVTTDGKGMPMFKDAGDGHWYATTPAIEGIVEAYATHELRSGRPMPLDNLRRFAKKLEYASPLTLEDCAAVRRDLAALRS… |
| A0A494X1V7 | 73-203 | PRIDAVFGPVESLLDTLVATGEIETLRNGVAGFRAPDGNLYPLAPALESVCVTYDKLARTHGWDDQTAGLRKLAKHFELDMPITQRE… |
| L2EIG8 | 42-154 | None |
| A0A356HBH0 | 10-116 | None |
| A0A202B584 | 1-132 | None |
| A0A261U492 | 25-154 | None |
| A0A1U9UVD8 | 37-160 | None |
| A0A1R1JTA1 | 5-129 | None |
| A0A0M0FPB3 | 5-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.