DPCstruct | MC4341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 249 ± 41 aa |
| Standard deviation of domain lengths | 40.95 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 43.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7TMQ2 | 8-228 | GNGGWMRIGYINMTEPGATCPQGLYSYTYGGKTLCDKSQGSGDGCNSTFFSAIGLSYTKVCGQARGYQYGPPDGFYPNIGGGSPNID… |
| A0A1X7V4Z3 | 89-364 | SCKAIKEVLPNSPSGYYYVNGRNIYCNMEELCGSGGGWTRLAYLDMTDATVNCPSGFRLYQSGSVRACGRPITSGGGCTSVQFPSNG… |
| A0A1X7UUP4 | 133-440 | None |
| A0A1X7T8W5 | 237-489 | None |
| A0A1X7TG89 | 32-222 | None |
| A0A1X7TJ08 | 38-329 | None |
| A0A1X7TPZ4 | 976-1236 | None |
| A0A1X7SSY1 | 8-208 | None |
| A0A1X7SNC5 | 50-308 | None |
| A0A1X7SRF7 | 58-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.