DPCstruct | MC43404
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Standard deviation of domain lengths | 7.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R7V5S6 | 1-68 | MNEVQRDSEEWFHMWNVLASNSINSGESECIHPESGEVWQYMGTKNGIHSFRHRHHPATGKVEYAHIQ |
| A0A3N1NJA7 | 1-76 | MEYLSMTSPEWETMWDQLAEDRLNQGDPICEFAGQAWEYMGSTKDHHHFRHPCHPATEKTEYIYLERAGVALAWAV |
| A0A8B0TI67 | 13-77 | None |
| A0A0E3BW30 | 7-70 | None |
| A0A7T5QQZ5 | 8-89 | None |
| A0A3N6SDI1 | 49-124 | None |
| A0A7S4LUR5 | 75-152 | None |
| A0A2W5V5B0 | 20-91 | None |
| K9T051 | 18-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.