DPCstruct | MC43403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 6.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19739 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7CXF2 | 1-85 | MDFFQLLADDWRGWGGERSWRSLDATMRITARHDGKGHVALGGTLHRDSYSPGGWLARVFITVEAGEEMTSLVADLRAHFEGLAR |
| A0A1B1TRR2 | 32-110 | IGAFFGDLAHHWQGWPGRKEWFSLEEELKLSATCDRLGHIFLLVNLKNGTPPVWNLQTELILEAGQLEDLAAQACAFEV |
| M2PZQ9 | 14-95 | None |
| A0A3L7VIM9 | 2-75 | None |
| A0A5B9DK97 | 52-128 | None |
| A0A2H3NPN9 | 88-173 | None |
| A0A0U3PS89 | 47-107 | None |
| A0A1I2IV85 | 181-260 | None |
| A0A0S4R027 | 123-199 | None |
| A0A366ZVP1 | 31-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.