DPCstruct | MC43401
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 6.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A495JKS8 | 35-112 | SRFVIHIPFKAPTLGTALGVAERLADFLTFIPEFDSTDTAVSLEDDQLNQHPVYCGTIIPTQGRCLYLYGHTDPCSTT |
| A0A1N6QFN7 | 10-84 | LPVSATDLPAAKRLARAITRALGFLPDVDPGEMTVSEEDAQFVRHRVFCDTRLDGGRRCRRLADHDGPCTAAVSR |
| A0A542XJM4 | 9-85 | None |
| A0A2G7DC26 | 26-106 | None |
| A0A3A9ZP73 | 17-94 | None |
| A0A1C6T8C4 | 6-83 | None |
| A0A1C5AMG2 | 2-63 | None |
| A0A248YTK7 | 78-158 | None |
| A0A7K3X052 | 96-160 | None |
| A0A7W7SR67 | 110-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.