DPCstruct | MC4340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 113 ± 15 aa |
| Standard deviation of domain lengths | 15.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 46.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7SED6 | 118-214 | CLSLAIDIFNTHRPLLSQSLSDPVSVAIMLQREGVITGQVLASVESASPSVPNQREVLLAAIIVAIESKYSLLQTFASVLCKFTGNV… |
| A0A1X7V1Z2 | 1-116 | HHVLVINIFNNRHTVLSQSLCDSVGIARLLYGERMLTQEAVSRVVSASPSISNQREALLTAVKKAVQTDPNSLHTFANVLCTISTNV… |
| A0A1X7SFY0 | 73-174 | None |
| A0A1X7SHF3 | 3-132 | None |
| A0A1X7T5P8 | 15-144 | None |
| A0A1X7SQV1 | 1-114 | None |
| A0A1X7T4Z3 | 43-170 | None |
| A0A1X7SJT9 | 11-106 | None |
| A0A1X7SDS4 | 43-142 | None |
| A0A1X7UGL0 | 54-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.