DPCstruct | MC434
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 69 ± 6 aa |
| Standard deviation of domain lengths | 5.67 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A430R599 | 1-61 | MERILKFMGKVLPDPGPEFDPEAVRELYAAQYPQLASASIVEREEDGVRVVEFVPRVGTKG |
| A0A521S0V0 | 1-73 | MDIQKVERVFEYGSLKLADPDPVMSPDRVKEFYATVYPELTQAVMGEPERRGATQVYKFTRAVGTKGGEQSPP |
| A0A561MAU9 | 1-71 | None |
| A0A0F9G0J6 | 1-63 | None |
| A0A0F9FZ99 | 1-61 | None |
| A0A3D1UWM1 | 137-202 | None |
| A0A6L7TNF3 | 94-159 | None |
| A0A841GRT5 | 16-81 | None |
| M4NE84 | 2-75 | None |
| A0A2K8UI27 | 4-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.