DPCstruct | MC43391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 17.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A124G3S7 | 9-121 | KITLRQRLIIQESLNQFSIGGLVRLAKHILLFTFFLEGLGTILLYLNWHNLESNHSPFFLSLFHAVSAFCNAGFSLFSDSLEQYTFH… |
| A0A1I1YZS5 | 85-213 | MIVQIGGVGVMTMGTAVWILLGKKIGMRERQLIMTDQNQSTLSGLVNLMRQILGLIMIIEFIGMVLFTVLFLKYYPSWKEALYHGFF… |
| A0A380EMI2 | 4-131 | None |
| A0A4R0SQX9 | 123-288 | None |
| A0A2Z5QY57 | 202-326 | None |
| A0A7Y5G806 | 109-252 | None |
| A0A4Q4CRD6 | 105-227 | None |
| A0A855HMR8 | 1-105 | None |
| I6ZQV7 | 216-383 | None |
| A0A416ZM68 | 65-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.