DPCstruct | MC4339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 18.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 69.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.29 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | PF05019- PF05180- PF08069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7RR13 | 1-78 | MAIYYTCKVCDTRNGPKHFSKVSYEEGVVLVQCESCQNHHIIADNLGWFSDLEGLKNIEEIMDRKGERVQKLSTKDLV |
| A0A1X7V1T8 | 37-146 | RPSLATNYLPSRRFCESSNAGSVTKSRVGSLKPRLQLLYTCNVCQTRSTKQFSKQAYDSGVVIVRCPSCKSLHLIADNLGWFGDQKQ… |
| K8FDA5 | 83-191 | None |
| A0A7I8KWN5 | 19-132 | None |
| A0A811LPE0 | 12-106 | None |
| A0A7S4RE76 | 12-134 | None |
| A0A835XN88 | 150-253 | None |
| A0A251T7G9 | 150-241 | None |
| A0A4V3WKY6 | 228-326 | None |
| A0A0M4F9I6 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.