DPCstruct | MC43388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 196 ± 17 aa |
| Standard deviation of domain lengths | 16.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3QDQ3 | 7-193 | LDSCVQSALSALYPPFDATAPTVLGQVFDVVEGTYRGDGLRYLIDFLVPAKRILQGIQQDACSAFSGLLFRHEGWPLCVHEKLIIQL… |
| A0A3B3HWA0 | 10-204 | YLYPPFQATSPTVLCQVLSVVESCFRGDGLQYLIHFLLPAKQLLQSVQQDACLPFSGLLFRHEGWPLCIHEKIVVQLCPLDPRLLQP… |
| A2AC60 | 6-183 | None |
| E7F579 | 2-187 | None |
| H3AE49 | 3-181 | None |
| A0A3Q1F765 | 2-206 | None |
| A0A670ZSJ2 | 2-180 | None |
| A0A3B4X8K2 | 1-167 | None |
| A0A6P4Z5S6 | 45-268 | None |
| A0A151NRG3 | 3-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.