DPCstruct | MC43387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 216 ± 25 aa |
| Standard deviation of domain lengths | 24.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 41.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B4FQN8 | 1-234 | MVKRKSLDENEPECGKGIPFPIQTFLWRQTSAFLRPKLGKQYEASCVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLH… |
| T1G359 | 1-187 | MMVKKSKDSVDSEDENSIPIPIQTFLWRQTSPFIRQKLAKLCESSALSFERVIVQNILHGLSPSLCEAIQSISRWKFVCASFPHVIH… |
| A0A4U5N3N6 | 21-236 | None |
| A0A7M5WIJ4 | 1-162 | None |
| A0A4U5N3D9 | 28-260 | None |
| A0A132A3I8 | 15-252 | None |
| A0A0L7L9D2 | 10-199 | None |
| A0A0D8Y3J6 | 29-249 | None |
| B7P419 | 1-207 | None |
| A0A182TN28 | 1-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.