DPCstruct | MC43386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 111 |
|---|---|
| Mean domain length (aa) | 264 ± 56 aa |
| Standard deviation of domain lengths | 55.74 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 90.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.96 |
| Pfam Score | 98.25 |
| Assigned Pfam label(s) | CL0392- CL0254- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7UUN6 | 240-570 | QVAAEMRDYILQALKELVGQWADVYTAQFIQYNPTFKTTYGFPAGYGSVQNLNDHHFHYGYFLRAAAAIGRYDRPWLDGYLPFFDEL… |
| G2WSD1 | 126-418 | LGKLKQAFARFAANKQKFPLVYERSWGGLVSSASYVTGNSGADFGNTDYNDHHFHYAYHVLAAAVIGHLDPSWIPENMAYVNLLVRD… |
| A0A7S1VDR7 | 29-261 | None |
| Q2GSD7 | 505-695 | None |
| G8LUU1 | 565-844 | None |
| A0A3P6CL11 | 110-354 | None |
| A0A081AJ76 | 34-287 | None |
| A0A7L5ADR0 | 725-1005 | None |
| A0A6G0SBT6 | 182-474 | None |
| A0A2G8LIY1 | 5-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.