DPCstruct | MC43380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 10.40 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7TL09 | 1-95 | MQWSKMKEQIESRLCESLRGRVVYNSTRYRGSHDKVGRSWITFDNEIIHDFCTVKLRYEFNIAADRIREESDSHDWRNPEQKDGYYE… |
| A0A644WJ38 | 7-108 | SWASLKIKAEGFLCDSLKGRIMYFLTYYHEVHNAYGRASIRLDGKEMICFSWIEMYHQERDVSEAQKEDSLLNYDDIVEGLKPNWDT… |
| A0A1G7SI92 | 55-156 | None |
| G9YTY1 | 1-99 | None |
| A0A6I7T6R3 | 3-93 | None |
| A0A1M6X4H9 | 1-91 | None |
| A0A073INQ1 | 22-123 | None |
| K1TL33 | 3-88 | None |
| A0A1S2LZE5 | 1-113 | None |
| A0A285LZH4 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.