DPCstruct | MC4338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 158 ± 24 aa |
| Standard deviation of domain lengths | 24.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 93.55 |
| Assigned Pfam label(s) | CL0382- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X7V1I9 | 4-153 | GAPPFDGATKRFAKPKSEEELEIIQKNSEPLTTARTNKWAVAVWNKWSKCRLDDHKEAPIGPPYLLPSKDDLYHWMTCFIVEIRCKD… |
| A0A7D9IFA2 | 2-135 | LDIGLLQQFLSSKNELRRIEDISVEQLNEYLSEFIISVRKKEDQGEYEPSSLRSMFASFERYLKKKNGFSIMMDKSSERARKALQSK… |
| A0A821XQE2 | 5-163 | None |
| A0A803JI63 | 246-396 | None |
| A0A6P8HI90 | 26-195 | None |
| A0A6P8HD22 | 8-163 | None |
| A0A6S7FMM0 | 217-348 | None |
| E9QFL0 | 526-662 | None |
| A0A6J8AQ77 | 40-199 | None |
| A0A2B4STZ7 | 449-595 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.