DPCstruct | MC43378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 162 ± 23 aa |
| Standard deviation of domain lengths | 23.29 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L5Y1L2 | 2-146 | LIFEEEGGRQIDFDLRGGEEEVLARLDPPAPSARRLGPGRPRLGVVAREVTLLPRHWEWLAAQPGGASTTLRKLVEAARKTDAGKTD… |
| A0A520S7B5 | 47-215 | LTQGSLADAALAARRYLDQNPARRALILRDSNSRLVDLDLSGDEDLLVRKAEHFVVPPSATTGLGSATSQEITLLPRHWEWLSTQGS… |
| A0A259J1M6 | 1-128 | None |
| A0A378ZP78 | 24-202 | None |
| A0A0Q4FY90 | 21-191 | None |
| A0A5B8BU11 | 11-171 | None |
| A0A7Y3JGK1 | 81-239 | None |
| A0A5C8ITY1 | 23-203 | None |
| G8NX09 | 23-191 | None |
| K6G9K9 | 139-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.