DPCstruct | MC43374
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 235 ± 29 aa |
| Standard deviation of domain lengths | 28.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078R201 | 82-341 | NLQRLMSDPYVREHLGLEINNGILVSKVKVSEVIKGLLKVVTDILNPEFKVSDIYNREKRKQYIDNFDKSQKPDLSNEASEQWSVQD… |
| A0A1C2Y099 | 1-249 | MLMILYDLIYEDLSVGDIYRKKDRIEYIESLKQRLMQENMESSDEQISENTREANNSQGGGYKASNSSGNNYYNNENTDSKQQSSSA… |
| A0A154L4U9 | 147-404 | None |
| A0A3E2YR65 | 390-588 | None |
| A0A369Y1P3 | 194-469 | None |
| A0A6L9HRZ2 | 5-219 | None |
| A0A485I685 | 71-302 | None |
| A0A090STQ2 | 90-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.