DPCstruct | MC43370
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 147 ± 12 aa |
| Standard deviation of domain lengths | 12.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 64.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212CL96 | 5-134 | FVQVNFIFFVSIIRILRQKLMSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIGISSKYQILFELCLGSFQGLVVAVLYCF… |
| A0A4Z2HPQ6 | 1-135 | MINFVFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLN… |
| A0A6I9YKF4 | 30-184 | None |
| A0A2I0TKN1 | 10-150 | None |
| A0A2D4JTN0 | 6-170 | None |
| A0A452QWQ9 | 28-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.