DPCstruct | MC4337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 320 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 63.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07807- PF07808 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9TX15 | 81-413 | KANLRRQAIEDQKGVDAVEKMSDNKMVRGIHRILFKNELPLRNELFGKGRMAYVVDMEDEEADIPTTLLRSVHDCPKAESNANINAN… |
| A0A1X7UYX3 | 2-361 | VVRDQEAEEIKKYERRRKKKRKRRDLSVLVRRDQSTKNIHSIVFQTNAPEKNEFFLPGRMAYVFELDDEYEESDIPTTLIRSKADCP… |
| A0A1A6GK58 | 131-445 | None |
| J9EIR8 | 2-324 | None |
| A0A7J6ZKB4 | 169-481 | None |
| A0A6A4WXI8 | 184-493 | None |
| A0A182VK03 | 63-370 | None |
| A0A061I3G6 | 38-334 | None |
| A0A498S674 | 375-695 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.