DPCstruct | MC43366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 222 ± 12 aa |
| Standard deviation of domain lengths | 11.93 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 61.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2HJD2 | 1-230 | MGCDGQGHISGKYTSHRSAGSCPLAAKRQKESSINGLPFAWKANKQELPHCPLPGCNGLGHANNVFATHRSLSGCPLNAQSIKKKPS… |
| A0A4W5MZ04 | 1-199 | MLNGNPFSWKTFKTEAPTCPTPDCDGSGHANGSFLTHRSLSGCPRASIAKKKAKFSGDEYLSTKFRASDVLDNDEDIKQLNKEINEL… |
| A0A6A1QH23 | 43-274 | None |
| A0A1A7X5E3 | 286-515 | None |
| A0A7J5ZGU0 | 1037-1264 | None |
| A0A2H1WLF7 | 11-240 | None |
| A0A6I9P8A0 | 1-210 | None |
| A0A7J8E3G9 | 605-808 | None |
| A0A803TF11 | 494-722 | None |
| A0A3B3ITS6 | 417-645 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.