DPCstruct | MC43365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 157 ± 10 aa |
| Standard deviation of domain lengths | 9.55 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8DWG4 | 1-152 | MSLHNLVHSFLNGTNALPHSAANDPIFVVLHCFTDAIFDEWMKRFNPSVDAWPQELAPIGHNRMYNMVPFFPPVTNEEFFLTADQLG… |
| A0A4Z2HHH8 | 1-182 | MHIALHVFMNGSMSSVQGSANDPIFLLHHAFVDSLYEQWLRRHRPSPARYPDSGAPIGHNGEYHMVPFLPLHTNRDFFISSKALGYE… |
| A0A672KL58 | 293-441 | None |
| A0A673HA12 | 225-376 | None |
| A0A6F9AXC6 | 114-264 | None |
| A0A4E0R7I6 | 127-294 | None |
| A0A401PZ68 | 232-383 | None |
| A0A3N0YR46 | 53-204 | None |
| A0A504YVJ2 | 350-502 | None |
| A0A6J3B081 | 595-746 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.