DPCstruct | MC43363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 7.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8FUF7 | 15-108 | LTYPVMLEKQENEGYRATVLGWPECQAFGSTREETLTSLRQIVTERLDKVEIVSLEIDRPKPEHPWMKFAGKYEDDPYFEEMQADIA… |
| A0A7C7QRH0 | 1-95 | MTYYVLVENGKQGNYTATVLGWPDCTAQGATRQEALARIRQALITRLARAEIVPLEIEHPHPGHPRLKFAGMFEDNPLFDDVLTEIE… |
| A0A2H3L5P1 | 1-73 | None |
| A0A0S3U9Q9 | 38-136 | None |
| A0A1Z4H5J3 | 16-109 | None |
| A0A1F8QX21 | 12-109 | None |
| A0A0P4UUC1 | 2-99 | None |
| A0A0P4UST6 | 1-96 | None |
| K9VIX1 | 124-218 | None |
| A0A2R5FTW8 | 52-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.