DPCstruct | MC43361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 124 ± 22 aa |
| Standard deviation of domain lengths | 22.49 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 90.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.92 |
| Pfam Score | 80.40 |
| Assigned Pfam label(s) | CL0105- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5UT80 | 389-515 | LPPGFRPALRFKTMVAQVRDFPPGSSISYGRTYRTSGQQRIAVLPVGYADGFRRAPHHWGEVLIRGRRAPIVGRVCMDYTMVEVSHI… |
| A0A6M1HWI2 | 44-132 | MTLKSSLIAVREHQAGEAVGYGGTWISPRDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGDA… |
| A0A837Q164 | 3-90 | None |
| A0A3L7PMW3 | 199-350 | None |
| A0A7L5AJH0 | 53-171 | None |
| A0A356C050 | 25-160 | None |
| W7ZJ88 | 110-229 | None |
| A0A2M8Q114 | 729-855 | None |
| A0A3P3VYN0 | 496-616 | None |
| A0A7Y7DFF3 | 284-413 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.