DPCstruct | MC43351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 71 ± 12 aa |
| Standard deviation of domain lengths | 12.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0667 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A448I6U6 | 1-55 | MFVCLCTGATSHEVADAVARGACTSKQVAVACGAGTDCGRCRRTVRAIIEAESAK |
| A0A2N3J6P1 | 4-90 | CITNHSHLDFTQLQHEVNPMYVCLCRGITDTQIRKAVQSGKSEFRQLKQSLEVGAQCGKCVRMTMEIIAAELDKMEQEQPVLYYQVA |
| A0A2E4FCJ4 | 8-70 | None |
| A0A6N9B4U2 | 15-74 | None |
| A0A3R7TNE3 | 1-54 | None |
| A0A7I7ZFL2 | 30-101 | None |
| A0A1E4HUR2 | 126-200 | None |
| A0A1A0X0G2 | 1-61 | None |
| A0A1A0KVL9 | 1-61 | None |
| A0A1Z1NT23 | 109-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.