DPCstruct | MC4335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 382 ± 47 aa |
| Standard deviation of domain lengths | 46.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.89 |
| Pfam Score | 57.14 |
| Assigned Pfam label(s) | CL0016- CL0154 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1W4P6 | 111-476 | KKARRLMLQRMPAAEMFAHLLDVHQEPADIADVSSTLTPTELVEIVMNEMTQQLVALTAACRVVPAPQKWIGSSVALAFDCGSLPSR… |
| A0A7J6NEH2 | 2-470 | YKSQARRLQYQRLSAQDFLTFFLDMRHAYSSDGPLSQGRTPEEYIELVLLQILRKLCKICSALSEMKIPQMWVGSSIALGFDAEGLD… |
| A0A813HK23 | 1-424 | None |
| A0A7S4N4W5 | 12-355 | None |
| A0A1Q9EB48 | 463-853 | None |
| A0A812TWY0 | 294-639 | None |
| A0A812S989 | 29-450 | None |
| A0A813GR83 | 1-334 | None |
| A0A812U279 | 103-436 | None |
| A0A7J6TKR9 | 2-404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.