DPCstruct | MC43349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 107 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I7L8J8 | 18-117 | LSELSMIEVAHAMLEEKGKEMDFNVLVNEIQDYLGKSDSEIRDRLSRFYTELNTDGSFIPLGNNVWALRSWYAIDEIDEEVVALDEL… |
| G8MZZ0 | 1-84 | MSLQQQYSPEELQEMSFVELANLILLDKREALPFDQLVREAAALAGISEEEMEARLAQYYTDLNIDGRFICVGGKRLGIARMVS |
| A0A1X1Q6N5 | 1-113 | None |
| A0A4V3G7W5 | 1-94 | None |
| A0A0U3MGZ8 | 3-106 | None |
| A0A1H3JJP0 | 14-122 | None |
| A0A5S9MII6 | 1-89 | None |
| A0A4R2RMI3 | 29-159 | None |
| A0A135L6W9 | 23-137 | None |
| A0A7X8FFF1 | 6-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.