DPCstruct | MC43343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 4.13 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8JLF9 | 64-138 | ARGLVNATGPWVKHFFDEGMHLRSPYGIRLIKGSHIVVPRVHTQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDV |
| A0A5S9I6E8 | 8-82 | ASYVVNMMGPWINHLLENVLDWKDIHQYNLSEGSHIWVPKLYAHDRAYVFQNGDGCIIFSIPYQEEFTLLGTTIL |
| A0A3M5P8N9 | 242-310 | None |
| A0A6A5L0J8 | 402-470 | None |
| A0A376VX69 | 84-153 | None |
| A0A2W5A0C3 | 113-190 | None |
| A0A3S4E6Y0 | 55-124 | None |
| J0QKE8 | 1-71 | None |
| A0A2V4VLF7 | 756-824 | None |
| A0A2G8THL4 | 444-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.