DPCstruct | MC4334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Standard deviation of domain lengths | 15.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6LAQ4 | 60-141 | CPTGDAQCQVDDPLSYCKYYLSAPVCKGSNKSCSCITPPPPCPEGDAYCQQVTGDPASYCKAVWQFGPGGGVCQGSDDTCTC |
| A0A7J6NBQ8 | 73-188 | TTGASTTTGASTTTEVSTTSIDNATCDAYCDQMSSGSFCKYWQVPSVCSGTDILCSCGQTTAHPPPSTASPTMSFTTSEPSVLKCDA… |
| C5LEY7 | 19-103 | None |
| C5L5E2 | 428-536 | None |
| C5L0F8 | 3-82 | None |
| A0A7J6UEF1 | 4-117 | None |
| A0A7J6PCR5 | 5-104 | None |
| A0A7J6LMQ5 | 460-571 | None |
| A0A7J6LG85 | 182-290 | None |
| A0A7J6KYL4 | 405-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.