DPCstruct | MC43332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 22.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07258 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4Q9K2 | 46-131 | NRLKRTQTSFKVKVFNIGQLVDFQWKLGVSVSSNHSQELNVPFISVFIKVLNSNNDISSHSFELTVPEFQDFAQQFKDIDSLMNAL |
| A0A813USL4 | 1-80 | MLPQLKDFNWYIDMKLVPGVNGQRIQQPSCVLSLDVNDPTKSANENEQTVQIELSKETLNLVLDNFTRIREQLNTLAKRE |
| A0A0P1ABN5 | 3-71 | None |
| A0A5F5XXM9 | 5-82 | None |
| A0A7S4HG86 | 83-151 | None |
| A0A672YH28 | 57-120 | None |
| A0A6A4JSB3 | 270-342 | None |
| T0MHT0 | 473-544 | None |
| A0A7R9QU16 | 1-81 | None |
| X6M6K9 | 186-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.