DPCstruct | MC4333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 17.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.64 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03941 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2N3R8 | 60-186 | PPQQEPWQILRGKVLPPKSGDDNYEISDKEDSADEMEEPDRSHKHVPSWSADWTEQLAKQEGVDPDSIFGSKVPLCNIDVIFPDVLY… |
| A0A7J6N7H1 | 15-130 | LPTLDANDQYDVSEKDTDNSDQEKGGKPKIKKRIPEWSRQWKRLVRDQASVDPESVFGCAVPATDLDQIFNDGNYRHMRMDRPRRKR… |
| A0A7S1RES6 | 317-441 | None |
| A0A812W9A1 | 71-199 | None |
| A0A812U5L4 | 640-755 | None |
| A0A813FN01 | 832-952 | None |
| A0A812VW25 | 1-127 | None |
| A0A7S0ZNQ3 | 250-412 | None |
| A0A7S2HRN1 | 56-210 | None |
| A0A7S1MS65 | 6-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.