DPCstruct | MC43326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 342 ± 47 aa |
| Standard deviation of domain lengths | 47.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.02 |
| Pfam Score | 96.21 |
| Assigned Pfam label(s) | CL0705- PF06625- PF15711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4PWM3 | 314-612 | KVSVGSCNRVYSSAQSYIYIDGRSKFTSGGDGLSITIYKDGYDESLVFKIVADDQVNNGSPSDIAVSKAANFILNRIPVGSVVAISL… |
| B4W199 | 4-282 | SARITLNDQEIGFVHYSRGLNVAVIDEATGQPLVCTTFDTFFPGNADRFADLVDKLPSGRIVAIAVKDDASANLSQRAKRACQSLGS… |
| A0A7M4FGX1 | 41-410 | None |
| F4PWM4 | 194-518 | None |
| F4PZ51 | 204-510 | None |
| A0A7M5TZM1 | 14-325 | None |
| A0A0N5CQH7 | 1-413 | None |
| V8D0R3 | 4-395 | None |
| D3FE87 | 259-608 | None |
| S9WRD1 | 1-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.