DPCstruct | MC43323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 148 ± 35 aa |
| Standard deviation of domain lengths | 35.39 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.67 |
| Pfam Score | 89.05 |
| Assigned Pfam label(s) | CL0172- CL0361- CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4PHC7 | 2-215 | NKEIEEFLKQNKSFVYNKETNRIKCEVTNHEMMPKIEQLKQHLTSKKYKMTIAYTFDYTKYEPYIIQSRNNEKIEEEGEEEEEEEED… |
| A0A5D6Y621 | 247-378 | IEALVGSLDDLAFIGDGSRVRCATTGHEMKADVDVVRAHLHGKRYVRAKLKRQSFASFAPMFAAHPDEKKAHLLWCRVTETEHPRDV… |
| A0A7E4VNY3 | 5-153 | None |
| A0A3Q0IY03 | 93-295 | None |
| D8RXY1 | 6-201 | None |
| A0A553MVK8 | 18-181 | None |
| A0A340XJ98 | 7-198 | None |
| L8YC44 | 42-170 | None |
| T1EKX2 | 3-94 | None |
| R7TRJ5 | 4-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.